PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G041800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 323aa    MW: 34911 Da    PI: 8.1096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G041800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-1763108147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Sevir.5G041800.1.p  63 RGHWRPAEDAKLKELVAQHGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 108
                         899*****************************.***********996 PP

2Myb_DNA-binding56.56.2e-18115158146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
  Sevir.5G041800.1.p 115 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHV 158
                         678*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.52558109IPR017930Myb domain
SMARTSM007172.4E-1462111IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-2863156IPR009057Homeodomain-like
PfamPF002492.0E-1663108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2664116IPR009057Homeodomain-like
CDDcd001679.03E-1466107No hitNo description
PROSITE profilePS5129426.73110164IPR017930Myb domain
SMARTSM007175.0E-15114162IPR001005SANT/Myb domain
PfamPF002494.6E-15115158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-20117161IPR009057Homeodomain-like
CDDcd001677.62E-8126159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAHDHEMVCF SGRAPPAAAL YPFRFHHHQE QEQAVVSEEV YHGHVEDPEE ISCGRGQGKL  60
CARGHWRPAE DAKLKELVAQ HGPQNWNLIA EKLDGRSGKS CRLRWFNQLD PRINRRAFSE  120
EEEERLLAAH RAYGNKWALI ARLFPGRTDN AVKNHWHVLA ARRQREQSGA LRRRKPSSCS  180
LSSLATAPTH AVAVAVHHHY SSPPPPFHAG GARIQHDIHT EAAAAATRAH SGGESEESAS  240
TCTTDLSLGS VGAAAVPCFY QSSYDGCDMA PCAAAPTPAA LAPSARSAFS VCSPARHRAA  300
ASDNGCGKLA RPFFDFLGVG AT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31611635107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0613681e-149BT061368.1 Zea mays full-length cDNA clone ZM_BFb0140D17 mRNA, complete cds.
GenBankEU9677751e-149EU967775.1 Zea mays clone 305974 mRNA sequence.
GenBankHQ8587991e-149HQ858799.1 Zea mays clone UT1886 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967704.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLK3XSY40.0K3XSY4_SETIT; Uncharacterized protein
STRINGSi005038m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-57myb domain protein 105